Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) automatically mapped to Pfam PF02533 |
Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
Protein Photosystem II reaction center protein K, PsbK [161039] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries) |
Domain d6jlok_: 6jlo K: [375479] Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jlof_, d6jloh_, d6jloi_, d6jloj_, d6jlol_, d6jlom_, d6jloo_, d6jlot_, d6jlou_, d6jlov_, d6jlox_, d6jloz_ automated match to d2axtk1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jlo (more details), 2.4 Å
SCOPe Domain Sequences for d6jlok_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlok_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d6jlok_: