Lineage for d6jlot_ (6jlo t:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026547Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 3026548Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 3026549Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 3026564Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries)
  8. 3026583Domain d6jlot_: 6jlo t: [375477]
    Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jlof_, d6jloh_, d6jloi_, d6jloj_, d6jlok_, d6jlol_, d6jlom_, d6jloo_, d6jlou_, d6jlov_, d6jlox_, d6jloz_
    automated match to d2axtt1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlot_

PDB Entry: 6jlo (more details), 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset2)
PDB Compounds: (t:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d6jlot_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlot_ f.23.34.1 (t:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d6jlot_:

Click to download the PDB-style file with coordinates for d6jlot_.
(The format of our PDB-style files is described here.)

Timeline for d6jlot_: