Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) automatically mapped to Pfam PF05151 |
Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries) |
Domain d6jlom_: 6jlo m: [375474] Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jlof_, d6jloh_, d6jloi_, d6jloj_, d6jlok_, d6jlol_, d6jloo_, d6jlot_, d6jlou_, d6jlov_, d6jlox_, d6jloz_ automated match to d2axtm1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jlo (more details), 2.4 Å
SCOPe Domain Sequences for d6jlom_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlom_ f.23.35.1 (m:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]} mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d6jlom_: