Lineage for d6jlom_ (6jlo m:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026592Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 3026593Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 3026594Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 3026607Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)
  8. 3026627Domain d6jlom_: 6jlo m: [375474]
    Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jlof_, d6jloh_, d6jloi_, d6jloj_, d6jlok_, d6jlol_, d6jloo_, d6jlot_, d6jlou_, d6jlov_, d6jlox_, d6jloz_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlom_

PDB Entry: 6jlo (more details), 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset2)
PDB Compounds: (m:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d6jlom_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlom_ f.23.35.1 (m:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d6jlom_:

Click to download the PDB-style file with coordinates for d6jlom_.
(The format of our PDB-style files is described here.)

Timeline for d6jlom_: