SCOPe 2.08: Domain d6jlje_: 6jlj e:

Lineage for d6jlje_ (6jlj e:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries)

8. Domain d6jlje_: 6jlj e: [375469]
   Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljl_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_, d6jljz_
   automated match to d2axte1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlje_

PDB Entry: 6jlj, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset1)

PDB Compounds: (e:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d6jlje_:

Sequence; same for both SEQRES and ATOM records:

>d6jlje_ f.23.38.1 (e:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk

Timeline for d6jlje_:

• d6jlje_ first appeared in SCOPe 2.07