Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries) |
Domain d6jlof_: 6jlo F: [375457] Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jloh_, d6jloi_, d6jloj_, d6jlok_, d6jlol_, d6jlom_, d6jloo_, d6jlot_, d6jlou_, d6jlov_, d6jlox_, d6jloz_ automated match to d3a0hf_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jlo (more details), 2.4 Å
SCOPe Domain Sequences for d6jlof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlof_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]} sypiftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d6jlof_: