SCOPe 2.08: Domain d6jlof_: 6jlo F:

Lineage for d6jlof_ (6jlo F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries)

8. Domain d6jlof_: 6jlo F: [375457]
   Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jloh_, d6jloi_, d6jloj_, d6jlok_, d6jlol_, d6jlom_, d6jloo_, d6jlot_, d6jlou_, d6jlov_, d6jlox_, d6jloz_
   automated match to d3a0hf_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlof_

PDB Entry: 6jlo, 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset2)

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d6jlof_:

Sequence; same for both SEQRES and ATOM records:

>d6jlof_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d6jlof_:

• d6jlof_ first appeared in SCOPe 2.07