Class a: All alpha proteins [46456] (289 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein automated matches [190276] (12 species) not a true protein |
Species Shewanella algae [TaxId:38313] [375398] (1 PDB entry) |
Domain d6hr0a_: 6hr0 A: [375399] automated match to d1m1ra_ complexed with hec, po3 |
PDB Entry: 6hr0 (more details), 1.04 Å
SCOPe Domain Sequences for d6hr0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hr0a_ a.138.1.3 (A:) automated matches {Shewanella algae [TaxId: 38313]} edqklsdfhadmggceschadgspsadgayefeqcqschgslaemdavhkphdgalmcad chaphdmnvgqkptcdschddgrtsdsvlk
Timeline for d6hr0a_: