Lineage for d6hr0a_ (6hr0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347351Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2347446Protein automated matches [190276] (12 species)
    not a true protein
  7. 2347506Species Shewanella algae [TaxId:38313] [375398] (1 PDB entry)
  8. 2347507Domain d6hr0a_: 6hr0 A: [375399]
    automated match to d1m1ra_
    complexed with hec, po3

Details for d6hr0a_

PDB Entry: 6hr0 (more details), 1.04 Å

PDB Description: optimizing electroactive organisms: the effect of orthologous proteins
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d6hr0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hr0a_ a.138.1.3 (A:) automated matches {Shewanella algae [TaxId: 38313]}
edqklsdfhadmggceschadgspsadgayefeqcqschgslaemdavhkphdgalmcad
chaphdmnvgqkptcdschddgrtsdsvlk

SCOPe Domain Coordinates for d6hr0a_:

Click to download the PDB-style file with coordinates for d6hr0a_.
(The format of our PDB-style files is described here.)

Timeline for d6hr0a_: