SCOPe 2.07: Domain d6ibkb1: 6ibk B:32-323

Lineage for d6ibkb1 (6ibk B:32-323)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Melibiase [75064] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102062] (21 PDB entries)
   alpha-galactosidase A

8. Domain d6ibkb1: 6ibk B:32-323 [375372]
   Other proteins in same PDB: d6ibka2, d6ibkb2
   automated match to d1r46b2
   complexed with act, bma, edo, man, nag, peg, so4, ytw

Details for d6ibkb1

PDB Entry: 6ibk, 1.99 Å

PDB Description: crystal structure of human alpha-galactosidase a in complex with alpha-galactose configured cyclosulfamidate me763

PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d6ibkb1:

Sequence; same for both SEQRES and ATOM records:

>d6ibkb1 c.1.8.1 (B:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp

Timeline for d6ibkb1:

• d6ibkb1 is new in SCOPe 2.07-stable
  
• d6ibkb1 appears in the current release, SCOPe 2.08