SCOPe 2.07: Domain d6ibmb2: 6ibm B:324-423

Lineage for d6ibmb2 (6ibm B:324-423)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries)
   alpha-galactosidase A

8. Domain d6ibmb2: 6ibm B:324-423 [375348]
   Other proteins in same PDB: d6ibma1, d6ibmb1
   automated match to d1r46b1
   complexed with act, bma, edo, hf8, man, nag, peg, so4

Details for d6ibmb2

PDB Entry: 6ibm, 2.07 Å

PDB Description: crystal structure of human alpha-galactosidase a in complex with alpha-galactose configured cyclosulfate me776

PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d6ibmb2:

Sequence; same for both SEQRES and ATOM records:

>d6ibmb2 b.71.1.1 (B:324-423) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmqm

Timeline for d6ibmb2:

• d6ibmb2 is new in SCOPe 2.07-stable
  
• d6ibmb2 appears in the current release, SCOPe 2.08