Lineage for d6hjxf1 (6hjx F:6-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2356177Domain d6hjxf1: 6hjx F:6-124 [375331]
    Other proteins in same PDB: d6hjxf2, d6hjxg2, d6hjxh2, d6hjxi2, d6hjxj2
    automated match to d5da4a_
    complexed with lmt, mes, na, p6g, pty; mutant

Details for d6hjxf1

PDB Entry: 6hjx (more details), 2.5 Å

PDB Description: x-ray structure of a pentameric ligand gated ion channel from erwinia chrysanthemi (elic) 7'c pore mutant (l238c) in complex with nanobody 72
PDB Compounds: (F:) nanobody 72

SCOPe Domain Sequences for d6hjxf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hjxf1 b.1.1.1 (F:6-124) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvyadfvk
grftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqvtvss

SCOPe Domain Coordinates for d6hjxf1:

Click to download the PDB-style file with coordinates for d6hjxf1.
(The format of our PDB-style files is described here.)

Timeline for d6hjxf1: