Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.0: automated matches [191547] (1 protein) not a true family |
Protein automated matches [190942] (7 species) not a true protein |
Species Fervidobacterium islandicum [TaxId:2423] [375276] (2 PDB entries) |
Domain d6a6fb1: 6a6f B:1-133 [375277] Other proteins in same PDB: d6a6fa2, d6a6fb2 automated match to d1xjsa_ complexed with gol, ni, peg, zn |
PDB Entry: 6a6f (more details), 2.1 Å
SCOPe Domain Sequences for d6a6fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a6fb1 d.224.1.0 (B:1-133) automated matches {Fervidobacterium islandicum [TaxId: 2423]} miysefimdysklkkfhgkienahkveegknlscgdevtlyflfdgdkivdvkfeghgca isqastnvmieqiigktkqealemmknaenmmlgkefdenvlgpiinfydvknypmrvkc fllpwktleialk
Timeline for d6a6fb1: