Lineage for d6a6fb1 (6a6f B:1-133)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613577Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2613578Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2613662Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 2613663Protein automated matches [190942] (7 species)
    not a true protein
  7. 2613682Species Fervidobacterium islandicum [TaxId:2423] [375276] (2 PDB entries)
  8. 2613684Domain d6a6fb1: 6a6f B:1-133 [375277]
    Other proteins in same PDB: d6a6fa2, d6a6fb2
    automated match to d1xjsa_
    complexed with gol, ni, peg, zn

Details for d6a6fb1

PDB Entry: 6a6f (more details), 2.1 Å

PDB Description: crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1
PDB Compounds: (B:) Iron-sulfur cluster assembly scaffold protein NifU

SCOPe Domain Sequences for d6a6fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a6fb1 d.224.1.0 (B:1-133) automated matches {Fervidobacterium islandicum [TaxId: 2423]}
miysefimdysklkkfhgkienahkveegknlscgdevtlyflfdgdkivdvkfeghgca
isqastnvmieqiigktkqealemmknaenmmlgkefdenvlgpiinfydvknypmrvkc
fllpwktleialk

SCOPe Domain Coordinates for d6a6fb1:

Click to download the PDB-style file with coordinates for d6a6fb1.
(The format of our PDB-style files is described here.)

Timeline for d6a6fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6a6fb2