SCOPe 2.07: Domain d6spva1: 6spv A:58-153

Lineage for d6spva1 (6spv A:58-153)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)

8. Domain d6spva1: 6spv A:58-153 [375256]
   automated match to d3gsla1
   complexed with gsh

Details for d6spva1

PDB Entry: 6spv, 2.04 Å

PDB Description: crystal structure of pdz1-2 from psd-95

PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d6spva1:

Sequence; same for both SEQRES and ATOM records:

>d6spva1 b.36.1.1 (A:58-153) automated matches {Homo sapiens [TaxId: 9606]}
egemeyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsi
lfvnevdvrevthsaavealkeagsivrlyvmrrkp

Timeline for d6spva1:

• d6spva1 is new in SCOPe 2.07-stable
  
• d6spva1 appears in the current release, SCOPe 2.08