Lineage for d6pfeb2 (6pfe B:193-521)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578670Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. 2578671Species Cryptosporidium hominis [TaxId:237895] [100887] (16 PDB entries)
  8. 2578708Domain d6pfeb2: 6pfe B:193-521 [375235]
    Other proteins in same PDB: d6pfea1, d6pfeb1, d6pfec1, d6pfed1, d6pfee1
    automated match to d1qzfa2
    complexed with mtx, ndp, oea, ufp

Details for d6pfeb2

PDB Entry: 6pfe (more details), 2.81 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, fdump and 2-(4-((2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2, 3-d]pyrimidin-5-yl)methyl)benzamido)-4-methoxybenzoic acid.
PDB Compounds: (B:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d6pfeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfeb2 d.117.1.1 (B:193-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
lksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvlenga
yrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgdtngnhliekk
vyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakli
etlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgsp
fniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkrk
veniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d6pfeb2:

Click to download the PDB-style file with coordinates for d6pfeb2.
(The format of our PDB-style files is described here.)

Timeline for d6pfeb2: