SCOPe 2.07: Domain d6phfb2: 6phf B:107-208

Lineage for d6phfb2 (6phf B:107-208)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6phfb2: 6phf B:107-208 [375211]
   Other proteins in same PDB: d6phfb1, d6phfd1
   automated match to d1lila2

Details for d6phfb2

PDB Entry: 6phf, 3.1 Å

PDB Description: pfs25 in complex with the human transmission blocking antibody 2587

PDB Compounds: (B:) 2587 Antibody Fab, Light Chain

SCOPe Domain Sequences for d6phfb2:

Sequence; same for both SEQRES and ATOM records:

>d6phfb2 b.1.1.2 (B:107-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d6phfb2:

• d6phfb2 is new in SCOPe 2.07-stable
  
• d6phfb2 appears in the current release, SCOPe 2.08