Lineage for d6rnda_ (6rnd A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447626Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2447677Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2447678Protein D-xylose isomerase [51666] (13 species)
  7. 2447806Species Streptomyces rubiginosus [TaxId:1929] [51670] (89 PDB entries)
  8. 2447874Domain d6rnda_: 6rnd A: [375202]
    automated match to d1mnza_
    complexed with glc, mg

Details for d6rnda_

PDB Entry: 6rnd (more details), 1.7 Å

PDB Description: liquid application method for time-resolved analyses (lama) by serial synchrotron crystallography, xylose isomerase 15 ms timepoint
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d6rnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rnda_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d6rnda_:

Click to download the PDB-style file with coordinates for d6rnda_.
(The format of our PDB-style files is described here.)

Timeline for d6rnda_: