SCOPe 2.07: Domain d6rnub_: 6rnu B:

Lineage for d6rnub_ (6rnu B:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (88 PDB entries)

8. Domain d6rnub_: 6rnu B: [375193]
   automated match to d1zy3a1
   complexed with br, kbh

Details for d6rnub_

PDB Entry: 6rnu, 2.4 Å

PDB Description: bcl-xl in a complex with a covalent small molecule inhibitor

PDB Compounds: (B:) Bcl-2-like protein 1

SCOPe Domain Sequences for d6rnub_:

Sequence, based on SEQRES records:

>d6rnub_ f.1.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelry
rrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqv
lvsriaawmatylndhlepwiqenggwdtfvelyg

Sequence, based on observed residues (ATOM records):

>d6rnub_ f.1.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsnrelvvdflsyklsqkgyswsqfseseavkqalreagdefelryrrafsdltsqlhi
tpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatyl
ndhlepwiqenggwdtfvelyg

Timeline for d6rnub_:

• d6rnub_ is new in SCOPe 2.07-stable
  
• d6rnub_ appears in the current release, SCOPe 2.08, called d6rnub1