Lineage for d6phcb1 (6phc B:1-105)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369120Domain d6phcb1: 6phc B:1-105 [375180]
    Other proteins in same PDB: d6phcb2, d6phcd2
    automated match to d1dn0a1
    complexed with gol

Details for d6phcb1

PDB Entry: 6phc (more details), 2.9 Å

PDB Description: pfs25 in complex with the human transmission blocking antibody 2544
PDB Compounds: (B:) 2544 Antibody Fab, Light Chain

SCOPe Domain Sequences for d6phcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6phcb1 b.1.1.0 (B:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqsllhngynyldwylqkpgqspqlliylgsnras
gvpdrfsgsgsgtdftlkisrveaedvgvyycmqtlqpftfgqgtrlei

SCOPe Domain Coordinates for d6phcb1:

Click to download the PDB-style file with coordinates for d6phcb1.
(The format of our PDB-style files is described here.)

Timeline for d6phcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6phcb2