Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (59 species) not a true protein |
Species Pseudoalteromonas fuliginea [TaxId:1872678] [375103] (2 PDB entries) |
Domain d6popc1: 6pop C:2-475 [375113] Other proteins in same PDB: d6popa2, d6popb2, d6popc2, d6popd2, d6pope2, d6popf2 automated match to d4qeta_ complexed with edo, mg, nap |
PDB Entry: 6pop (more details), 2.15 Å
SCOPe Domain Sequences for d6popc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6popc1 c.82.1.0 (C:2-475) automated matches {Pseudoalteromonas fuliginea [TaxId: 1872678]} lskqlyiggklitsdatteiinpatleivgeisaagineanmalesaqeafsswsttpai eraqwmlklrdavianeqhlrecvhlemakpwqstaddfqmlvdslnfyadaivniadee ikdnegthshvlsrepvgvaaaflawnfpllnlayklgpamaagcplvvkpssktplsay avgelceqiglpagvvnilsgmdstvgdaisastipsvltligstnvgkhviatgatsik rysmelggnapaivcsdanldnaadvicgvkfanagqicvtpnrvfvhesvadefiekvl trakavkvgfdkneaidmgpvmdanswqridelvkdaqqngaqlqlggkkptgvngyfye ptvltnvdssmkiykdeifgpvisiiifsdneqvlsdandtdaglssfifssnedtisyf akhlrfgevqvngikysinlphfgikqsgvgvdcsllalddylaykrvsralkv
Timeline for d6popc1: