Lineage for d6pfab1 (6pfa B:3-179)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2510891Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 2510892Species Cryptosporidium hominis [TaxId:237895] [102636] (15 PDB entries)
    Uniprot Q5CGA3 Q27552
  8. 2510919Domain d6pfab1: 6pfa B:3-179 [375032]
    Other proteins in same PDB: d6pfaa2, d6pfab2, d6pfac2, d6pfad2, d6pfae2
    automated match to d1qzfa1
    complexed with mtx, ndp, of4, so4, ufp

Details for d6pfab1

PDB Entry: 6pfa (more details), 2.79 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, fdump and 2-((4-((2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2, 3-d]pyrimidin-5-yl)methyl)benzamido)methyl)benzoic acid.
PDB Compounds: (B:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d6pfab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfab1 c.71.1.1 (B:3-179) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqe

SCOPe Domain Coordinates for d6pfab1:

Click to download the PDB-style file with coordinates for d6pfab1.
(The format of our PDB-style files is described here.)

Timeline for d6pfab1: