SCOPe 2.08: Domain d6mssb1: 6mss B:5-116

Lineage for d6mssb1 (6mss B:5-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6mssb1: 6mss B:5-116 [375000]
   Other proteins in same PDB: d6mssa2, d6mssc1, d6mssc3, d6mssd_
   automated match to d3q5ya1
   complexed with nag, srv

Details for d6mssb1

PDB Entry: 6mss, 3 Å

PDB Description: diversity in the type ii natural killer t cell receptor repertoire and antigen specificity leads to differing cd1d docking strategies

PDB Compounds: (B:) A11B8.2 NKT TCR beta-chain

SCOPe Domain Sequences for d6mssb1:

Sequence; same for both SEQRES and ATOM records:

>d6mssb1 b.1.1.0 (B:5-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipdg
ykasrpsqenfslilelatpsqtsvyfcasgdpqgvsyeqyfgpgtrltvle

Timeline for d6mssb1:

• d6mssb1 first appeared in SCOPe 2.07