Class b: All beta proteins [48724] (178 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries) |
Domain d6s50b1: 6s50 B:15-136 [374910] Other proteins in same PDB: d6s50a3, d6s50b3 automated match to d2bc3a2 complexed with 4ir, gol, so4 |
PDB Entry: 6s50 (more details), 2 Å
SCOPe Domain Sequences for d6s50b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s50b1 b.61.1.1 (B:15-136) automated matches {Streptomyces avidinii [TaxId: 1895]} agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawastlvghdtftkvk ps
Timeline for d6s50b1: