SCOPe 2.07: Domain d6s8na_: 6s8n A:

Lineage for d6s8na_ (6s8n A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [374834] (1 PDB entry)

8. Domain d6s8na_: 6s8n A: [374871]
   automated match to d4wbsa_
   complexed with dcq, l0w, lmn, lmt

Details for d6s8na_

PDB Entry: 6s8n, 3.1 Å

PDB Description: cryo-em structure of lptb2fgc in complex with lipopolysaccharide

PDB Compounds: (A:) Lipopolysaccharide ABC transporter, ATP-binding protein LptB

SCOPe Domain Sequences for d6s8na_:

Sequence; same for both SEQRES and ATOM records:

>d6s8na_ c.37.1.0 (A:) automated matches {Shigella flexneri [TaxId: 623]}
atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvkrvylgedfr

Timeline for d6s8na_:

• d6s8na_ is new in SCOPe 2.07-stable
  
• d6s8na_ appears in the current release, SCOPe 2.08