Class a: All alpha proteins [46456] (289 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) |
Family a.6.1.0: automated matches [191604] (1 protein) not a true family |
Protein automated matches [191102] (6 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [374605] (2 PDB entries) |
Domain d6jgfa_: 6jgf A: [374783] automated match to d5crlb_ complexed with po4 |
PDB Entry: 6jgf (more details), 2.15 Å
SCOPe Domain Sequences for d6jgfa_:
Sequence, based on SEQRES records: (download)
>d6jgfa_ a.6.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]} mkigelakatdcavetiryyereqllpeparsdgnyrlytqahverltfirncrtldmtl deirsllrlrdspddscgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaeca ilqqle
>d6jgfa_ a.6.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]} mkigelakatdcavetiryyereqllpeplytqahverltfirncrtldmtldeirsllr lrdspddsgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaecailqqle
Timeline for d6jgfa_: