Lineage for d6jgfa_ (6jgf A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309714Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2309715Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2309833Family a.6.1.0: automated matches [191604] (1 protein)
    not a true family
  6. 2309834Protein automated matches [191102] (6 species)
    not a true protein
  7. 2309860Species Pseudomonas putida [TaxId:303] [374605] (2 PDB entries)
  8. 2309861Domain d6jgfa_: 6jgf A: [374783]
    automated match to d5crlb_
    complexed with po4

Details for d6jgfa_

PDB Entry: 6jgf (more details), 2.15 Å

PDB Description: crystal structure of se-met cadr from p. putida with a 21 residue c- terminal truncation
PDB Compounds: (A:) CadR

SCOPe Domain Sequences for d6jgfa_:

Sequence, based on SEQRES records: (download)

>d6jgfa_ a.6.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
mkigelakatdcavetiryyereqllpeparsdgnyrlytqahverltfirncrtldmtl
deirsllrlrdspddscgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaeca
ilqqle

Sequence, based on observed residues (ATOM records): (download)

>d6jgfa_ a.6.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
mkigelakatdcavetiryyereqllpeplytqahverltfirncrtldmtldeirsllr
lrdspddsgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaecailqqle

SCOPe Domain Coordinates for d6jgfa_:

Click to download the PDB-style file with coordinates for d6jgfa_.
(The format of our PDB-style files is described here.)

Timeline for d6jgfa_: