SCOPe 2.07: Domain d6pxgf2: 6pxg F:111-212

Lineage for d6pxgf2 (6pxg F:111-212)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
Domain d6pxgf2: 6pxg F:111-212 [374692]
Other proteins in same PDB: d6pxgb1, d6pxgd1, d6pxgf1, d6pxgl1
automated match to d2fbjl2

Details for d6pxgf2

PDB Entry: 6pxg (more details), 2.1 Å

PDB Description: crystal structure of mers-cov neutralizing antibody g2 fab

PDB Compounds: (F:) G2 Fab Light chain

SCOPe Domain Sequences for d6pxgf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pxgf2 b.1.1.2 (F:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d6pxgf2:

Click to download the PDB-style file with coordinates for d6pxgf2.
(The format of our PDB-style files is described here.)

Timeline for d6pxgf2: