SCOPe 2.07: Domain d6pxaj1: 6pxa J:1-217

Lineage for d6pxaj1 (6pxa J:1-217)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (35 species)
   not a true protein

7. Species Vibrio fischeri [TaxId:312309] [330859] (2 PDB entries)

8. Domain d6pxaj1: 6pxa J:1-217 [374688]
   Other proteins in same PDB: d6pxaa2, d6pxab2, d6pxac2, d6pxae2, d6pxag2, d6pxai2, d6pxaj2, d6pxak2
   automated match to d5ux9d_
   complexed with act, cl, fmt, gol, so4, tch

Details for d6pxaj1

PDB Entry: 6pxa, 1.82 Å

PDB Description: the crystal structure of chloramphenicol acetyltransferase-like protein from vibrio fischeri es114 in complex with taurocholic acid

PDB Compounds: (J:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d6pxaj1:

Sequence; same for both SEQRES and ATOM records:

>d6pxaj1 b.81.1.0 (J:1-217) automated matches {Vibrio fischeri [TaxId: 312309]}
meafnswlegqnlkeqvknpnievgdysyysgfyhsktfeeqavryllgdaptqevwesg
qfgevdklrigkfcsiasgatfmmagnqghradwistfpfskkefgegvkdgfqragdti
vgndvwigseamimpgvhigdgaiigaravitknvapysvvvgnnvvvkkrfdenliqtl
lvikwwdwplqhikntmeilcsghieeleqyfiknvg

Timeline for d6pxaj1:

• d6pxaj1 is new in SCOPe 2.07-stable
  
• d6pxaj1 appears in the current release, SCOPe 2.08