SCOPe 2.07: Domain d6rska1: 6rsk A:-4-103

Lineage for d6rska1 (6rsk A:-4-103)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries)
   Uniprot P00044

8. Domain d6rska1: 6rsk A:-4-103 [374550]
   Other proteins in same PDB: d6rska2, d6rskb2
   automated match to d5t8wa_
   complexed with evb, hec, so4, spm

Details for d6rska1

PDB Entry: 6rsk, 2.31 Å

PDB Description: cytochrome c co-crystallized with 20 eq. sulfonato-calix[8]arene and 15 eq. spermine - structure ii

PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d6rska1:

Sequence; same for both SEQRES and ATOM records:

>d6rska1 a.3.1.1 (A:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d6rska1:

• d6rska1 is new in SCOPe 2.07-stable
  
• d6rska1 appears in the current release, SCOPe 2.08