Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species) fat depleting factor related to class I MHC |
Species Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries) Uniprot P25311 22-294 |
Domain d6r2ue2: 6r2u E:184-278 [374458] Other proteins in same PDB: d6r2ua1, d6r2ub1, d6r2uc1, d6r2ud1, d6r2ue1, d6r2uf1 automated match to d1t7va1 complexed with 11d, azi, so4 |
PDB Entry: 6r2u (more details), 2.49 Å
SCOPe Domain Sequences for d6r2ue2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r2ue2 b.1.1.2 (E:184-278) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq swvvvavppqdtapyschvqhsslaqplvvpweas
Timeline for d6r2ue2: