Lineage for d1tvxb_ (1tvx B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635819Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1635820Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1635821Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1635977Protein Platelet basic protein, PBP [54148] (1 species)
    synonym: Small inducible cytokine B7; Neutrophil-activating peptide-2 (NAP-2), Connective tissue activating peptide-III (CTAP-III)
  7. 1635978Species Human (Homo sapiens) [TaxId:9606] [54149] (3 PDB entries)
  8. 1635980Domain d1tvxb_: 1tvx B: [37442]

Details for d1tvxb_

PDB Entry: 1tvx (more details), 1.75 Å

PDB Description: neutrophil activating peptide-2 variant form m6l with five additional amino terminal residues (dsdly)
PDB Compounds: (B:) neutrophil activating peptide 2 variant

SCOPe Domain Sequences for d1tvxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvxb_ d.9.1.1 (B:) Platelet basic protein, PBP {Human (Homo sapiens) [TaxId: 9606]}
dsdlyaelrclcikttsgihpkniqslevigkgthcnqveviatlkdgrkicldpdapri
kkivqkklagd

SCOPe Domain Coordinates for d1tvxb_:

Click to download the PDB-style file with coordinates for d1tvxb_.
(The format of our PDB-style files is described here.)

Timeline for d1tvxb_: