Class b: All beta proteins [48724] (178 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (17 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein Guanine nucleotide-binding protein subunit beta-2-like 1 (GNB2L1 or RACK1) [267639] (2 species) |
Species Oryctolagus cuniculus [TaxId:9986] [374334] (2 PDB entries) |
Domain d6p4gh_: 6p4g h: [374335] automated match to d3j3ag_ |
PDB Entry: 6p4g (more details), 3.1 Å
SCOPe Domain Sequences for d6p4gh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p4gh_ b.69.4.1 (h:) Guanine nucleotide-binding protein subunit beta-2-like 1 (GNB2L1 or RACK1) {Oryctolagus cuniculus [TaxId: 9986]} teqmtlrgtlkghngwvtqiattpqfpdmilsasrdktiimwkltrdetnygipqralrg hshfvsdvvissdgqfalsgswdgtlrlwdlttgtttrrfvghtkdvlsvafssdnrqiv sgsrdktiklwntlgvckytvqdeshsewvscvrfspnssnpiivscgwdklvkvwnlan cklktnhightgylntvtvspdgslcasggkdgqamlwdlnegkhlytldggdiinalcf spnrywlcaatgpsikiwdlegkiivdelkqevistsskaeppqctslawsadgqtlfag ytdnlvrvwqvti
Timeline for d6p4gh_: