Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein automated matches [190399] (10 species) not a true protein |
Species Aedes aegypti [TaxId:7159] [374205] (1 PDB entry) |
Domain d6mfbb_: 6mfb B: [374273] automated match to d2ch1a1 complexed with plp |
PDB Entry: 6mfb (more details), 2.5 Å
SCOPe Domain Sequences for d6mfbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mfbb_ c.67.1.3 (B:) automated matches {Aedes aegypti [TaxId: 7159]} mkftpppsslrgplvipdkimmgpgpsncskrvlaalnntclsnfhdelfqvidevkdgl ryifqtenrttmcitgsahtgmeallcnlleegdivlianngiwaerainmatrygadvr vlegpadkpfsmtdfkkaieqhrpkclfvvhgdsssgllqpleglgkichdydclllvda vaslcgvpfymdkweidgvytgsqkvlgappgitpisispkalevirsrktpskvfywdl lilgnywgcydeqkryhhtvpsnlifalreaiaqiaeeglepvirrrqecaeqmyrglqa mgleifvkdpeyrlptvtcimipkgvnwwkvseyamnnfsleiqggfgptmgiawragim gesstlqrvnfylyafkeslkathp
Timeline for d6mfbb_: