Lineage for d6mfbb_ (6mfb B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503335Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2503603Protein automated matches [190399] (10 species)
    not a true protein
  7. 2503604Species Aedes aegypti [TaxId:7159] [374205] (1 PDB entry)
  8. 2503606Domain d6mfbb_: 6mfb B: [374273]
    automated match to d2ch1a1
    complexed with plp

Details for d6mfbb_

PDB Entry: 6mfb (more details), 2.5 Å

PDB Description: crystal structure of 3-hydroxykynurenine transaminase from aedes aegypti
PDB Compounds: (B:) Serine--pyruvate aminotransferase

SCOPe Domain Sequences for d6mfbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mfbb_ c.67.1.3 (B:) automated matches {Aedes aegypti [TaxId: 7159]}
mkftpppsslrgplvipdkimmgpgpsncskrvlaalnntclsnfhdelfqvidevkdgl
ryifqtenrttmcitgsahtgmeallcnlleegdivlianngiwaerainmatrygadvr
vlegpadkpfsmtdfkkaieqhrpkclfvvhgdsssgllqpleglgkichdydclllvda
vaslcgvpfymdkweidgvytgsqkvlgappgitpisispkalevirsrktpskvfywdl
lilgnywgcydeqkryhhtvpsnlifalreaiaqiaeeglepvirrrqecaeqmyrglqa
mgleifvkdpeyrlptvtcimipkgvnwwkvseyamnnfsleiqggfgptmgiawragim
gesstlqrvnfylyafkeslkathp

SCOPe Domain Coordinates for d6mfbb_:

Click to download the PDB-style file with coordinates for d6mfbb_.
(The format of our PDB-style files is described here.)

Timeline for d6mfbb_: