SCOPe 2.07: Domain d6mrab1: 6mra B:5-116

Lineage for d6mrab1 (6mra B:5-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6mrab1: 6mra B:5-116 [374270]
   Other proteins in same PDB: d6mraa2
   automated match to d3q5ya1

Details for d6mrab1

PDB Entry: 6mra, 1.7 Å

PDB Description: diversity in the type ii natural killer t cell receptor repertoire and antigen specificity leads to differing cd1d docking strategies

PDB Compounds: (B:) TCR beta-chain

SCOPe Domain Sequences for d6mrab1:

Sequence; same for both SEQRES and ATOM records:

>d6mrab1 b.1.1.0 (B:5-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipdg
ykasrpsqenfslilelatpsqtsvyfcasgdpqgvsyeqyfgpgtrltvle

Timeline for d6mrab1:

• d6mrab1 is new in SCOPe 2.07-stable
  
• d6mrab1 appears in the current release, SCOPe 2.08