Lineage for d6jy4g_ (6jy4 G:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578064Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 2578065Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 2578066Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 2578067Species Cow (Bos taurus) [TaxId:9913] [81408] (49 PDB entries)
  8. 3074116Domain d6jy4g_: 6jy4 G: [374178]
    Other proteins in same PDB: d6jy4a_, d6jy4b1, d6jy4b2, d6jy4c_, d6jy4d_, d6jy4e_, d6jy4f_, d6jy4h_, d6jy4i_, d6jy4j_, d6jy4k_, d6jy4l_, d6jy4m_
    automated match to d1v54g_
    complexed with cdl, chd, cqx, cu, cua, hea, mg, na, pek, pgv, zn

Details for d6jy4g_

PDB Entry: 6jy4 (more details), 1.95 Å

PDB Description: monomeric form of bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d6jy4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy4g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
gartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpfswgdgnhtffh
nprvnplptgye

SCOPe Domain Coordinates for d6jy4g_:

Click to download the PDB-style file with coordinates for d6jy4g_.
(The format of our PDB-style files is described here.)

Timeline for d6jy4g_: