Lineage for d6hwng_ (6hwn G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462684Species Thermus thermophilus [TaxId:274] [374087] (2 PDB entries)
  8. 2462691Domain d6hwng_: 6hwn G: [374161]
    Other proteins in same PDB: d6hwna2, d6hwnd2
    automated match to d5g1sq_
    complexed with peg

Details for d6hwng_

PDB Entry: 6hwn (more details), 1.95 Å

PDB Description: structure of thermus thermophilus clpp in complex with a tripeptide.
PDB Compounds: (G:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6hwng_:

Sequence, based on SEQRES records: (download)

>d6hwng_ c.14.1.0 (G:) automated matches {Thermus thermophilus [TaxId: 274]}
vipyvieqtargervydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeikl
yinspggevdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmi
hqpwggvrgtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqeale
yglidqvvtree

Sequence, based on observed residues (ATOM records): (download)

>d6hwng_ c.14.1.0 (G:) automated matches {Thermus thermophilus [TaxId: 274]}
vipyvieydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeiklyinspgge
vdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmihqpwggvr
gtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqealeyglidqvv
tree

SCOPe Domain Coordinates for d6hwng_:

Click to download the PDB-style file with coordinates for d6hwng_.
(The format of our PDB-style files is described here.)

Timeline for d6hwng_: