Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [374087] (2 PDB entries) |
Domain d6hwng_: 6hwn G: [374161] Other proteins in same PDB: d6hwna2, d6hwnd2 automated match to d5g1sq_ complexed with peg |
PDB Entry: 6hwn (more details), 1.95 Å
SCOPe Domain Sequences for d6hwng_:
Sequence, based on SEQRES records: (download)
>d6hwng_ c.14.1.0 (G:) automated matches {Thermus thermophilus [TaxId: 274]} vipyvieqtargervydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeikl yinspggevdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmi hqpwggvrgtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqeale yglidqvvtree
>d6hwng_ c.14.1.0 (G:) automated matches {Thermus thermophilus [TaxId: 274]} vipyvieydiysrllkdriiflgtpidaqvanvvvaqllfldaqnpnqeiklyinspgge vdaglaiydtmqfvrapvstivigmaasmaavilaagekgrryalphakvmihqpwggvr gtasdiaiqaqeilkakkllneilakhtgqplekvekdtdrdyylsaqealeyglidqvv tree
Timeline for d6hwng_: