SCOPe 2.07: Domain d6i3hb1: 6i3h B:1-157

Lineage for d6i3hb1 (6i3h B:1-157)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains
   automatically mapped to Pfam PF00598

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein automated matches [190930] (4 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [188440] (2 PDB entries)

8. Domain d6i3hb1: 6i3h B:1-157 [374145]
   Other proteins in same PDB: d6i3ha2, d6i3hb2
   automated match to d1aa7a_
   complexed with po4; mutant

Details for d6i3hb1

PDB Entry: 6i3h, 1.9 Å

PDB Description: crystal structure of influenza a virus m1 n-terminal domain (g18a mutation)

PDB Compounds: (B:) matrix protein 1

SCOPe Domain Sequences for d6i3hb1:

Sequence, based on SEQRES records:

>d6i3hb1 a.95.1.1 (B:1-157) automated matches {Influenza A virus, different strains [TaxId: 11320]}
mslltevetyvlsivpsaplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
gfvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeialsys
agalascmgliynrmgavttevafglvcatceqiads

Sequence, based on observed residues (ATOM records):

>d6i3hb1 a.95.1.1 (B:1-157) automated matches {Influenza A virus, different strains [TaxId: 11320]}
mslltevetyvlsivpsaplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
gfvftltvpqrrrfvqnalngnpnnmdkavklyrklkreitfhgakeialsysagalasc
mgliynrmgavttevafglvcatceqiads

Timeline for d6i3hb1:

• d6i3hb1 is new in SCOPe 2.07-stable
  
• d6i3hb1 appears in the current release, SCOPe 2.08