Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [359373] (10 PDB entries) |
Domain d6j33a3: 6j33 A:288-402 [374139] Other proteins in same PDB: d6j33a1, d6j33a4, d6j33a5, d6j33b1, d6j33b4, d6j33b5 automated match to d2fhfa1 complexed with act, ca, mg |
PDB Entry: 6j33 (more details), 1.3 Å
SCOPe Domain Sequences for d6j33a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j33a3 b.1.18.0 (A:288-402) automated matches {Klebsiella pneumoniae [TaxId: 573]} yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk
Timeline for d6j33a3: