SCOPe 2.07: Domain d6rqqa_: 6rqq A:

Lineage for d6rqqa_ (6rqq A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries)

8. Domain d6rqqa_: 6rqq A: [374053]
   automated match to d5dvxa_
   complexed with fmt, zn

Details for d6rqqa_

PDB Entry: 6rqq, 1.28 Å

PDB Description: x-ray crystal structure of protiated (h) large monoclinic unit cell ca ix sv.

PDB Compounds: (A:) Carbonic anhydrase 9

SCOPe Domain Sequences for d6rqqa_:

Sequence; same for both SEQRES and ATOM records:

>d6rqqa_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hwryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnng
hsvqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstky
arvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallps
dfsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratq
plngrvieasfpagvd

Timeline for d6rqqa_:

• d6rqqa_ is new in SCOPe 2.07-stable
  
• d6rqqa_ appears in the current release, SCOPe 2.08