Lineage for d6o5db_ (6o5d B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2413962Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2413963Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)
  8. 2414055Domain d6o5db_: 6o5d B: [373977]
    automated match to d3tf6a_
    complexed with gol, so4

Details for d6o5db_

PDB Entry: 6o5d (more details), 2.4 Å

PDB Description: pyochelin
PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d6o5db_:

Sequence, based on SEQRES records: (download)

>d6o5db_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
dlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksyn
vtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkk
vsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records): (download)

>d6o5db_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
dlipapplskvplqqnfqdnqfqgkwyvvglagnailpqkmyatiyelkedksynvtsvl
frkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvsqnr
eyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d6o5db_:

Click to download the PDB-style file with coordinates for d6o5db_.
(The format of our PDB-style files is described here.)

Timeline for d6o5db_: