Lineage for d6mcyd1 (6mcy D:21-181)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2627094Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 2627095Protein automated matches [195066] (5 species)
    not a true protein
  7. 2627127Species Mouse (Mus musculus) [TaxId:10090] [195067] (5 PDB entries)
  8. 2627136Domain d6mcyd1: 6mcy D:21-181 [373971]
    Other proteins in same PDB: d6mcya2, d6mcyb2, d6mcyc2, d6mcyd2
    automated match to d2imta_
    complexed with edo, fmt

Details for d6mcyd1

PDB Entry: 6mcy (more details), 1.75 Å

PDB Description: crystal structure of mouse bak
PDB Compounds: (D:) bcl-2 homologous antagonist/killer

SCOPe Domain Sequences for d6mcyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mcyd1 f.1.4.0 (D:21-181) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrqlalig
ddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyrlalyv
yqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnf

SCOPe Domain Coordinates for d6mcyd1:

Click to download the PDB-style file with coordinates for d6mcyd1.
(The format of our PDB-style files is described here.)

Timeline for d6mcyd1: