SCOPe 2.07: Domain d6icea1: 6ice A:1-114

Lineage for d6icea1 (6ice A:1-114)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (3 proteins)
   automatically mapped to Pfam PF01187

6. Protein automated matches [373933] (1 species)
   not a true protein

7. Species Mesocricetus auratus [TaxId:10036] [373934] (1 PDB entry)

8. Domain d6icea1: 6ice A:1-114 [373940]
   Other proteins in same PDB: d6icea2
   automated match to d1gifa_

Details for d6icea1

PDB Entry: 6ice, 1.8 Å

PDB Description: crystal structure of hamster mif

PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d6icea1:

Sequence; same for both SEQRES and ATOM records:

>d6icea1 d.80.1.3 (A:1-114) automated matches {Mesocricetus auratus [TaxId: 10036]}
pmftvntnvprasvpegllseltqqlaqatgkpaqyiavhvvpdqlmtfsgssdpcalcs
lhsigkiggaqnrtyskllcglladrlhispdriyinyydmsaanvgwngstfa

Timeline for d6icea1:

• d6icea1 is new in SCOPe 2.07-stable
  
• d6icea1 appears in the current release, SCOPe 2.08