SCOPe 2.07: Domain d6reys_: 6rey S:

Lineage for d6reys_ (6rey S:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Human (Homo sapiens) [TaxId:9606] [311422] (14 PDB entries)

8. Domain d6reys_: 6rey S: [373906]
   Other proteins in same PDB: d6reyh_, d6reyi_, d6reyj_, d6reyk_, d6reyl_, d6reym_, d6reyv_, d6reyw_, d6reyx_, d6reyy_, d6reyz_
   automated match to d4g4se_
   complexed with i6p, k0w

Details for d6reys_

PDB Entry: 6rey, 3 Å

PDB Description: human 20s-pa200 proteasome complex

PDB Compounds: (S:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d6reys_:

Sequence, based on SEQRES records:

>d6reys_ d.153.1.4 (S:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
lqfgeedadpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqss
lqevyhksmtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikd
i

Sequence, based on observed residues (ATOM records):

>d6reys_ d.153.1.4 (S:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
mfltrseydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplme
pssiekiveidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnla
rpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhksmtlkea
ikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi

Timeline for d6reys_:

• d6reys_ is new in SCOPe 2.07-stable
  
• d6reys_ appears in the current release, SCOPe 2.08