Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
Species Human (Homo sapiens) [TaxId:9606] [311422] (14 PDB entries) |
Domain d6rgqd_: 6rgq D: [373850] Other proteins in same PDB: d6rgqa_, d6rgqh_, d6rgqi_, d6rgqj_, d6rgqk_, d6rgql_, d6rgqm_, d6rgqv_, d6rgqw_, d6rgqx_, d6rgqy_, d6rgqz_ automated match to d1irud_ |
PDB Entry: 6rgq (more details), 2.6 Å
SCOPe Domain Sequences for d6rgqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rgqd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]} sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeai etddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeie
Timeline for d6rgqd_: