Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries) |
Domain d6pxwa4: 6pxw A:468-591 [373746] Other proteins in same PDB: d6pxwa1, d6pxwa2, d6pxwa3, d6pxwb1, d6pxwb2, d6pxwb3 automated match to d2dtge3 |
PDB Entry: 6pxw (more details), 3.1 Å
SCOPe Domain Sequences for d6pxwa4:
Sequence, based on SEQRES records: (download)
>d6pxwa4 b.1.2.0 (A:468-591) automated matches {Human (Homo sapiens) [TaxId: 9606]} cenellkfsyirtsfdkillrwepywppdfrdllgfmlfykeapyqnvtefdgqdacgsn swtvvdidpplrsndpksqnhpgwlmrglkpwtqyaifvktlvtfsderrtygaksdiiy vqtd
>d6pxwa4 b.1.2.0 (A:468-591) automated matches {Human (Homo sapiens) [TaxId: 9606]} cenellkfsyirtsfdkillrwepywppdfrdllgfmlfykeapyqnvtefswtvvdidp plrsndpksqnhpgwlmrglkpwtqyaifvktlvtfsderrtygaksdiiyvqtd
Timeline for d6pxwa4:
View in 3D Domains from other chains: (mouse over for more information) d6pxwb1, d6pxwb2, d6pxwb3, d6pxwb4 |