Lineage for d6pxwa4 (6pxw A:468-591)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2372249Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2372250Protein automated matches [190976] (5 species)
    not a true protein
  7. 2372274Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries)
  8. 2372388Domain d6pxwa4: 6pxw A:468-591 [373746]
    Other proteins in same PDB: d6pxwa1, d6pxwa2, d6pxwa3, d6pxwb1, d6pxwb2, d6pxwb3
    automated match to d2dtge3

Details for d6pxwa4

PDB Entry: 6pxw (more details), 3.1 Å

PDB Description: cryo-em structure of full-length insulin receptor bound to 4 insulin. 3d refinement was focused on the top part of the receptor complex.
PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d6pxwa4:

Sequence, based on SEQRES records: (download)

>d6pxwa4 b.1.2.0 (A:468-591) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cenellkfsyirtsfdkillrwepywppdfrdllgfmlfykeapyqnvtefdgqdacgsn
swtvvdidpplrsndpksqnhpgwlmrglkpwtqyaifvktlvtfsderrtygaksdiiy
vqtd

Sequence, based on observed residues (ATOM records): (download)

>d6pxwa4 b.1.2.0 (A:468-591) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cenellkfsyirtsfdkillrwepywppdfrdllgfmlfykeapyqnvtefswtvvdidp
plrsndpksqnhpgwlmrglkpwtqyaifvktlvtfsderrtygaksdiiyvqtd

SCOPe Domain Coordinates for d6pxwa4:

Click to download the PDB-style file with coordinates for d6pxwa4.
(The format of our PDB-style files is described here.)

Timeline for d6pxwa4: