Lineage for d1plfb_ (1plf B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536142Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2536143Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2536144Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2536324Protein Platelet factor 4, PF4 [54121] (2 species)
  7. 2536325Species Cow (Bos taurus) [TaxId:9913] [54122] (1 PDB entry)
  8. 2536327Domain d1plfb_: 1plf B: [37374]
    complexed with tcn

Details for d1plfb_

PDB Entry: 1plf (more details), 2.2 Å

PDB Description: the three-dimensional structure of bovine platelet factor 4 at 3.0 angstroms resolution
PDB Compounds: (B:) platelet factor 4

SCOPe Domain Sequences for d1plfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plfb_ d.9.1.1 (B:) Platelet factor 4, PF4 {Cow (Bos taurus) [TaxId: 9913]}
edlqcvclkttsginprhisslevigaglhcpspqliatlktgrkicldqqnplykkiik
rllks

SCOPe Domain Coordinates for d1plfb_:

Click to download the PDB-style file with coordinates for d1plfb_.
(The format of our PDB-style files is described here.)

Timeline for d1plfb_: