SCOPe 2.07: Domain d6p50l2: 6p50 L:107-211

Lineage for d6p50l2 (6p50 L:107-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d6p50l2: 6p50 L:107-211 [373692]
   Other proteins in same PDB: d6p50l1
   automated match to d1dqdl2
   complexed with nag

Details for d6p50l2

PDB Entry: 6p50, 2.9 Å

PDB Description: crystal structure of a complex of human il-7ralpha with an anti-il- 7ralpha fab 4a10

PDB Compounds: (L:) anti-IL-7R 4A10 Fab light chain

SCOPe Domain Sequences for d6p50l2:

Sequence; same for both SEQRES and ATOM records:

>d6p50l2 b.1.1.2 (L:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqd
skdstynmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d6p50l2:

• d6p50l2 is new in SCOPe 2.07-stable
  
• d6p50l2 appears in the current release, SCOPe 2.08