SCOPe 2.07: Domain d6onma1: 6onm A:61-263

Lineage for d6onma1 (6onm A:61-263)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (11 species)
   not a true protein

7. Species Citrus sinensis [TaxId:2711] [332182] (4 PDB entries)

8. Domain d6onma1: 6onm A:61-263 [373656]
   Other proteins in same PDB: d6onma2
   automated match to d3n0fa1
   complexed with mn, mwg

Details for d6onma1

PDB Entry: 6onm, 2.7 Å

PDB Description: crystal structure of (+)-limonene synthase complexed with 8,9- difluorolinalyl diphosphate

PDB Compounds: (A:) (+)-limonene synthase

SCOPe Domain Sequences for d6onma1:

Sequence, based on SEQRES records:

>d6onma1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]}
siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
epeirnilrnihnhnkdynwrkenlyatslefrllrqhgypvsqevfsgfkddkvgficd
dfkgilslheasyyslegesimeeawqftskhlkemmitsnskeedvfvaeqakralelp
lhwkapmlearwfihvyekredk

Sequence, based on observed residues (ATOM records):

>d6onma1 a.102.4.0 (A:61-263) automated matches {Citrus sinensis [TaxId: 2711]}
siwdhdflqslnsnytdetykrraeelkgkvktaikdvtepldqlelidnlqrlglayhf
epeirnilrnihnhnkenlyatslefrllrqhgypvsqevfsgfkddkvgficddfkgil
slheasyyslegesimeeawqftskhlkemdvfvaeqakralelplhwkapmlearwfih
vyekredk

Timeline for d6onma1:

• d6onma1 is new in SCOPe 2.07-stable
  
• d6onma1 appears in the current release, SCOPe 2.08