SCOPe 2.07: Domain d6k7cc_: 6k7c C:

Lineage for d6k7cc_ (6k7c C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (25 species)
   not a true protein

7. Species Shewanella violacea [TaxId:60217] [324148] (2 PDB entries)

8. Domain d6k7cc_: 6k7c C: [373598]
   automated match to d5b6qa_
   complexed with hec, no3

Details for d6k7cc_

PDB Entry: 6k7c, 1.15 Å

PDB Description: dimeric shewanella violacea cytochrome c5

PDB Compounds: (C:) Soluble cytochrome cA

SCOPe Domain Sequences for d6k7cc_:

Sequence; same for both SEQRES and ATOM records:

>d6k7cc_ a.3.1.0 (C:) automated matches {Shewanella violacea [TaxId: 60217]}
qegkavydkachichsmgvagapkahdaaawepriaqgldtlvstvktgkgamppggmct
dctdedyksaieymsk

Timeline for d6k7cc_:

• d6k7cc_ is new in SCOPe 2.07-stable
  
• d6k7cc_ appears in the current release, SCOPe 2.08