Lineage for d6hx2b_ (6hx2 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314869Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2315115Species Listeria innocua [TaxId:272626] [373578] (2 PDB entries)
  8. 2315117Domain d6hx2b_: 6hx2 B: [373582]
    automated match to d1qgha_
    complexed with co

Details for d6hx2b_

PDB Entry: 6hx2 (more details), 1.6 Å

PDB Description: the structure of dps from listeria innocua soaked with cobalt
PDB Compounds: (B:) DNA protection during starvation protein

SCOPe Domain Sequences for d6hx2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hx2b_ a.25.1.1 (B:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 272626]}
mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
dkegddvtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d6hx2b_:

Click to download the PDB-style file with coordinates for d6hx2b_.
(The format of our PDB-style files is described here.)

Timeline for d6hx2b_: