Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (16 species) |
Species Listeria innocua [TaxId:272626] [373578] (2 PDB entries) |
Domain d6hx2b_: 6hx2 B: [373582] automated match to d1qgha_ complexed with co |
PDB Entry: 6hx2 (more details), 1.6 Å
SCOPe Domain Sequences for d6hx2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hx2b_ a.25.1.1 (B:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 272626]} mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt dkegddvtndmliafkasidkhiwmfkaflgkaple
Timeline for d6hx2b_: