Lineage for d6pyrb_ (6pyr B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2646825Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2647023Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) (S)
    Pfam PF16454
  5. 2647024Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins)
  6. 2647028Protein automated matches [310859] (2 species)
    not a true protein
  7. 2647040Species Human (Homo sapiens) [TaxId:9606] [311240] (7 PDB entries)
  8. 2647041Domain d6pyrb_: 6pyr B: [373519]
    automated match to d5vlrb_
    complexed with p5j

Details for d6pyrb_

PDB Entry: 6pyr (more details), 2.21 Å

PDB Description: human pi3kdelta in complex with compound 2-10 ((3s)-3-benzyl-3-methyl- 5-[5-(2-methylpyrimidin-5-yl)pyrazolo[1,5-a]pyrimidin-3-yl]-1,3- dihydro-2h-indol-2-one)
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d6pyrb_:

Sequence, based on SEQRES records: (download)

>d6pyrb_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet
ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk
kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

Sequence, based on observed residues (ATOM records): (download)

>d6pyrb_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yqednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikifee
qcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkkqaaey
reidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

SCOPe Domain Coordinates for d6pyrb_:

Click to download the PDB-style file with coordinates for d6pyrb_.
(The format of our PDB-style files is described here.)

Timeline for d6pyrb_: