Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) Pfam PF16454 |
Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins) |
Protein automated matches [310859] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311240] (7 PDB entries) |
Domain d6pyrb_: 6pyr B: [373519] automated match to d5vlrb_ complexed with p5j |
PDB Entry: 6pyr (more details), 2.21 Å
SCOPe Domain Sequences for d6pyrb_:
Sequence, based on SEQRES records: (download)
>d6pyrb_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg
>d6pyrb_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} yqednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikifee qcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkkqaaey reidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg
Timeline for d6pyrb_: