Lineage for d6ajcd_ (6ajc D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513204Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2513401Protein automated matches [190072] (22 species)
    not a true protein
  7. 2513565Species Trypanosoma cruzi [TaxId:353153] [373333] (1 PDB entry)
  8. 2513569Domain d6ajcd_: 6ajc D: [373400]
    automated match to d1t0la_
    complexed with ca, ict, nap

Details for d6ajcd_

PDB Entry: 6ajc (more details), 2.4 Å

PDB Description: crystal structure of trypanosoma cruzi cytosolic isocitrate dehydrogenase in complex with nadp+, isocitrate and ca2+
PDB Compounds: (D:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d6ajcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ajcd_ c.77.1.1 (D:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
sqkikvagtvveldgdemtrviwkmikeelifpfldvpieyydlgmenrdktddqvtvda
ahaikkhgvgvkcatitpdearvrefnlkqmwkspngtirnilggtvfrepimcknvprl
vttwkhpivigrhafgdqyratdlvvngpgtfeihfvpesggaaqvqkvfdfksggvlmg
myntdesikdfakscfeyalskkwplylstkntilkrydgrfkdifaemykasyeadykk
agiwyehrliddmvayamkseggyvwacknydgdvqsdsvaqgfgslglmtsvlmspdgr
tveaeaahgtvtrhyrqhqkgeetstnpvasifawtrglmhrgkldqneklvqfsmllek
vvvstieagfmtkdlaicikgmnhvtrsdylntqefihklademrkayerski

SCOPe Domain Coordinates for d6ajcd_:

Click to download the PDB-style file with coordinates for d6ajcd_.
(The format of our PDB-style files is described here.)

Timeline for d6ajcd_: