SCOPe 2.07: Domain d6hb8d1: 6hb8 D:24-265

Lineage for d6hb8d1 (6hb8 D:24-265)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d6hb8d1: 6hb8 D:24-265 [373375]
   Other proteins in same PDB: d6hb8a2, d6hb8b2, d6hb8c2, d6hb8d2
   automated match to d4s2kb_
   complexed with cl, edo, etx, gol, so4

Details for d6hb8d1

PDB Entry: 6hb8, 1.86 Å

PDB Description: crystal structure of oxa-517 beta-lactamase

PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d6hb8d1:

Sequence; same for both SEQRES and ATOM records:

>d6hb8d1 e.3.1.0 (D:24-265) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafd
ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
iiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip

Timeline for d6hb8d1:

• d6hb8d1 is new in SCOPe 2.07-stable
  
• d6hb8d1 appears in the current release, SCOPe 2.08