SCOPe 2.07: Domain d6oe8a2: 6oe8 A:142-302

Lineage for d6oe8a2 (6oe8 A:142-302)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein automated matches [254656] (4 species)
   not a true protein

7. Species Arthrobacter globiformis [TaxId:1665] [255720] (5 PDB entries)

8. Domain d6oe8a2: 6oe8 A:142-302 [373323]
   automated match to d1vaxa1
   complexed with mli, pg4, pge; mutant

Details for d6oe8a2

PDB Entry: 6oe8, 1.99 Å

PDB Description: the crystal structure of hyper-thermostable aguricase mutant k12c/e286c

PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d6oe8a2:

Sequence; same for both SEQRES and ATOM records:

>d6oe8a2 d.96.1.4 (A:142-302) automated matches {Arthrobacter globiformis [TaxId: 1665]}
seqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarwryntvevdfda
vyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnkhhflvdlqpfg
qdnpnevfyaadrpyglieatiqrcgsradhpiwsniagfc

Timeline for d6oe8a2:

• d6oe8a2 is new in SCOPe 2.07-stable
  
• d6oe8a2 appears in the current release, SCOPe 2.08